PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0402100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 194aa    MW: 20346.9 Da    PI: 10.4486
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0402100.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.85.2e-132165347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  ORGLA03G0402100.1 21 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 65
                       6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6051470IPR017930Myb domain
SuperFamilySSF466898.97E-171671IPR009057Homeodomain-like
SMARTSM007179.3E-111868IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.3E-171868IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.8E-112164IPR009057Homeodomain-like
CDDcd001676.30E-112166No hitNo description
PfamPF002491.7E-112165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
GGHGEKGSAK SAEQERRKGI AWTEDEHRLF LLGLEKYGKG DWRSISRNFV ISRTPTQVAS  60
HAQKYFIRLN SMNRERRRSS IHDITSVNNG DTSAAQGPIT GQPNGPSANP GKSSKQSPQP  120
ANAPPGVDAY GTTIGQPVGG PLVSAVGTPV TLPVPAAPHI AYGMHAPVPG AVVPGAPVNM  180
PPMPYPMPPP TSHG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0686230.0AK068623.1 Oryza sativa Japonica Group cDNA clone:J013153N23, full insert sequence.
GenBankAK1061660.0AK106166.1 Oryza sativa Japonica Group cDNA clone:001-208-B07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636999.11e-138PREDICTED: transcription factor DIVARICATA
TrEMBLB8ARG21e-139B8ARG2_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA014092-PA1e-139(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.12e-64MYB family protein